Protein Info for BPHYT_RS31740 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 42 to 58 (17 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 152 to 175 (24 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 258 to 284 (27 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 300 (293 residues), 171.8 bits, see alignment E=8.3e-55

Best Hits

Swiss-Prot: 50% identical to BRAD_PSEAE: High-affinity branched-chain amino acid transport system permease protein BraD (braD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6412)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T8R3 at UniProt or InterPro

Protein Sequence (316 amino acids)

>BPHYT_RS31740 ABC transporter permease (Burkholderia phytofirmans PsJN)
MDIFIQQIINGLVLGSVYAIIALGYTMVYGILGIINFAHGDVLMVGAMVALSAITVLQDH
FPELGHVPTLLIALILAAAVCAMVGYTIEKVAYRPLRRAPRLAPLITAIGVSILLQTAAM
IIWGRNPLAFPQLLPTAPLNLIQASENHPGAVISLTEIAIVVVAFFVMAGLLLLVHRTKL
GRAMRAIAENPNVASLMGVNPGFVISATFMIGSALAALAGVMIASEYGNAHFYMGFIPGL
KAFTAAVLGGIGNLGGAMVGGVILGLVEQLGAGYIGTLTGGVFGSNYQDVFAFVVLIAVL
VFRPSGLLGERVADRA