Protein Info for BPHYT_RS31255 in Burkholderia phytofirmans PsJN

Annotation: cytochrome B561

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 transmembrane" amino acids 19 to 37 (19 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 12 to 179 (168 residues), 100 bits, see alignment E=7e-33

Best Hits

KEGG orthology group: K12262, cytochrome b561 (inferred from 100% identity to bpy:Bphyt_6306)

Predicted SEED Role

"Cytochrome B561"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TB37 at UniProt or InterPro

Protein Sequence (191 amino acids)

>BPHYT_RS31255 cytochrome B561 (Burkholderia phytofirmans PsJN)
MGKVYETRLPAYDAVARTLHWLTAVLIAMQFVIGWTMPDVHKDTQPVGLIAWHLGVGSAL
IAVMLVRVLWRLTHWPSPEDLPPLLNTVSRITHFLLYAALLAVPLLGWINASSRGWTVRL
LGVVPYPALSEPGSAFGHEMGDVHGVLAWVLFTLIGLHVVAALFHRFVLKDHVLQRMLPQ
AGPSRLPARNE