Protein Info for BPHYT_RS31040 in Burkholderia phytofirmans PsJN

Annotation: sugar transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF02563: Poly_export" amino acids 79 to 178 (100 residues), 75.2 bits, see alignment E=3.8e-25 PF10531: SLBB" amino acids 186 to 231 (46 residues), 24 bits, see alignment 2.8e-09 amino acids 270 to 321 (52 residues), 20.3 bits, see alignment 4e-08

Best Hits

Swiss-Prot: 49% identical to EPSA_RALSO: EPS I polysaccharide export outer membrane protein EpsA (epsA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01991, polysaccharide export outer membrane protein (inferred from 100% identity to bpy:Bphyt_6263)

Predicted SEED Role

"Polysaccharide export lipoprotein Wza" in subsystem Colanic acid biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAZ4 at UniProt or InterPro

Protein Sequence (385 amino acids)

>BPHYT_RS31040 sugar transporter (Burkholderia phytofirmans PsJN)
MRNRFASLIQRLSLCSVVALGACAFAPGMSFDPHKPIDPEDPSSVPVITPITFKLIEQES
SARKAAIAADTSYASLIAPPAPYRIGAQDVLSIIVWDHPELVMPNLSYAIGTDSGASPAT
VGMAAQSLPGFVVSKDGYVQFPYVKKIKASGLTELQLQQELIDHLKQNLNDPQVTVRVIG
YRSQKAYIDGEVRQPGVKQITDVPMTLAEMLNLANGVAATGDLSRIELTRGGITHWINLP
EMLKRGINPKDIAIRDQDAIRVPPLIEHRVVVSGEVVKPGPVVFKTNGHLTLSDALGDAG
GVSQLSGDAGEIYVVRAKSDDGLPKIFHLDSKSPTGMVLAAGFEMKPDDVVYVDAPGVIR
WYRVVTPLVGSATGAYYLQRTTTGN