Protein Info for BPHYT_RS30690 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 17 to 41 (25 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 97 to 120 (24 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 220 to 237 (18 residues), see Phobius details amino acids 320 to 345 (26 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details amino acids 406 to 429 (24 residues), see Phobius details PF01654: Cyt_bd_oxida_I" amino acids 9 to 436 (428 residues), 552.7 bits, see alignment E=2.3e-170

Best Hits

KEGG orthology group: K00425, cytochrome bd-I oxidase subunit I [EC: 1.10.3.-] (inferred from 100% identity to bpy:Bphyt_6192)

MetaCyc: 63% identical to cyanide insensitive ubiquinol oxidase subunit I (Pseudomonas putida KT2440)
RXN-6883 [EC: 1.10.3.11]

Predicted SEED Role

"putative Cytochrome bd2, subunit I" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 1.10.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T8F5 at UniProt or InterPro

Protein Sequence (462 amino acids)

>BPHYT_RS30690 membrane protein (Burkholderia phytofirmans PsJN)
MEIFDAFHLARLQFAFTVSFHIIFPAISIGMASFLAVLEWRWLLTGDVVYKDMFLFWSKI
FAVGFGMGVVSGVVMAYEFGTNWSGFSTVAGNITGPLLTYEVLTAFFLEAGFLGVMLFGW
QRVGPRAHFFATLMVAAGTLMSTFWILASNSFMQTPQGFAMENGRIVPVDWLKVIFNPSF
PYRLAHMTIAAFIVAGFMVAACGAWHLLHGRRDGPIKRSFSMALWILLLLTPIQIFVGDA
HGLNTREYQPAKIAAIEGLWETEKGGTALNLVGLPDMKAEVTRYTLQIPHLGSLILTHSW
DGEIRGLKTFPARDRPYSPIIFWTFRIMAGLGMLMLLTALLGLLLRLKGRLYETRWYQVF
VLCMGPSGIVALLAGWVTTEVGRQPWTVYGVLRTEDSLSPISAQQAGVSLLIFVLVYFLV
FGMGVYYMLKMMKRGPEEHVDARQSVKHPVLRNRPLDALERE