Protein Info for BPHYT_RS30185 in Burkholderia phytofirmans PsJN

Annotation: DNA-directed RNA polymerase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 49 to 74 (26 residues), see Phobius details amino acids 115 to 141 (27 residues), see Phobius details amino acids 163 to 188 (26 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 131 to 310 (180 residues), 97 bits, see alignment E=6e-32

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to bpy:Bphyt_6088)

Predicted SEED Role

"Dipeptide transport system permease protein dppC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAS0 at UniProt or InterPro

Protein Sequence (315 amino acids)

>BPHYT_RS30185 DNA-directed RNA polymerase subunit alpha (Burkholderia phytofirmans PsJN)
MSQPTNPHHVPHAGTELYDVRRDELVVEPAPVEVAPLKQGVFKRLVHRFSVLGLIGLLMV
AFWLLVAFIGPLVAPYKGGALTSTEIFGRYSAAYPLGTDYLGRDMLSRILYGARYTVGLA
LAAAVLASVIGTFFGLLAAVSGRVVDEILSRLFDALISIPSKVLALVVIAAFGSSIPMLT
TVAAAAYIPGAFRISRSLAVNVMSLEYVQVARARGEGIFYIARVEVLPNMIHPMLADFGL
RFVFIVLLLSGLSFLGLGVQPPNADWGSLVRENIGGLSEGAPAVLMPAIAIATLTIGMNL
LIDNLRRRSRKHGGA