Protein Info for BPHYT_RS30135 in Burkholderia phytofirmans PsJN

Annotation: SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF01135: PCMT" amino acids 42 to 131 (90 residues), 23.7 bits, see alignment E=1.7e-08 PF13489: Methyltransf_23" amino acids 46 to 159 (114 residues), 33.2 bits, see alignment E=1.8e-11 PF01209: Ubie_methyltran" amino acids 49 to 150 (102 residues), 60.2 bits, see alignment E=8.7e-20 PF07021: MetW" amino acids 49 to 145 (97 residues), 22.3 bits, see alignment E=4.1e-08 PF13847: Methyltransf_31" amino acids 50 to 150 (101 residues), 59 bits, see alignment E=2.2e-19 PF13649: Methyltransf_25" amino acids 55 to 148 (94 residues), 74.2 bits, see alignment E=5.3e-24 PF08241: Methyltransf_11" amino acids 56 to 150 (95 residues), 78.2 bits, see alignment E=2.7e-25 PF08242: Methyltransf_12" amino acids 56 to 150 (95 residues), 34.7 bits, see alignment E=1.1e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6077)

Predicted SEED Role

"PUTATIVE METHYLTRANSFERASE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAQ9 at UniProt or InterPro

Protein Sequence (277 amino acids)

>BPHYT_RS30135 SAM-dependent methyltransferase (Burkholderia phytofirmans PsJN)
MSEVHSSSQTSEFADVKARQHAAWETGNYAVVGTTLQIVGENLCEALDLRAGSRVLDVAA
GNGNGTLAAARRWCDVTSTDYVASLLDAGKARAQAEGLTAVQFREADAEALPYADASFDV
VMSTFGVMFTPNQEKAASELARVCRPGGKIGLANWTPESFIGQVFKTIGKYLPPPPGLKS
PALWGTRARLDELFDGSVRSVAVTSREFMFRYHSPAHWLEVFRTYYGPINKAFAAMDGER
QAAFQRDLMTLMESRNRSGDGTLVLPSEYLEIVMVRQ