Protein Info for BPHYT_RS30100 in Burkholderia phytofirmans PsJN

Annotation: copper oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF07732: Cu-oxidase_3" amino acids 87 to 192 (106 residues), 125.5 bits, see alignment E=1.9e-40 PF07731: Cu-oxidase_2" amino acids 149 to 192 (44 residues), 22.6 bits, see alignment 1.2e-08 amino acids 219 to 332 (114 residues), 86.9 bits, see alignment E=1.7e-28 PF00394: Cu-oxidase" amino acids 243 to 327 (85 residues), 23.6 bits, see alignment E=7.3e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6070)

MetaCyc: 70% identical to MoxA manganese-oxidizing multicopper oxidase (Pedomicrobium sp. ACM 3067)
RXN-11646 [EC: 1.16.3.3]

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.16.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAQ2 at UniProt or InterPro

Protein Sequence (431 amino acids)

>BPHYT_RS30100 copper oxidase (Burkholderia phytofirmans PsJN)
MVSRRHFMGGSGAALLGAALVSKAGAASLPEAPTMTTASMQPPRAPSNGRPYTPVATLNG
WSLPWRMKNGWKEFHLIAEPVVRELAPGMRANLWGYNGQAPGPTIEAVEGDKVRIFVTNR
LPEHTTVHWHGMLLPCGMDGVGGLTQPHIPPGKTFVYEFQLEKHGTFMYHPHADEMVQMA
MGMMGTFIVHPKDPGVMQVDRDFVFIMSAYDIDPGSFTPRVNEMTDFNMWTWNARVFPGI
DSLPARAGDRVRIRVGNLTMTNHPIHLHGYHFEVVGTDGGWIPPSARWPEVTADIAVGQM
RAIEFTANRPGDWAFHCHKSHHTMNAMGHQVPNMIGVPQKDLAKRINQLVPDYMAMGSTG
GSMGAMEMPLPDNTLPMMTGTGPFGALEMGGMFSVVKVREGLGRNDYRDPGWFRHPKGTV
AYEYTGELPDG