Protein Info for BPHYT_RS29940 in Burkholderia phytofirmans PsJN

Annotation: hemagglutinin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 964 transmembrane" amino acids 32 to 54 (23 residues), see Phobius details PF05658: YadA_head" amino acids 128 to 152 (25 residues), 19.3 bits, see alignment (E = 1.7e-07) amino acids 201 to 224 (24 residues), 12.8 bits, see alignment (E = 1.9e-05) amino acids 231 to 254 (24 residues), 19.5 bits, see alignment (E = 1.5e-07) amino acids 244 to 266 (23 residues), 12 bits, see alignment (E = 3.5e-05) amino acids 813 to 830 (18 residues), 11.3 bits, see alignment (E = 5.5e-05) amino acids 818 to 841 (24 residues), 25.8 bits, see alignment (E = 1.6e-09) amino acids 832 to 856 (25 residues), 15.9 bits, see alignment (E = 2e-06) PF05662: YadA_stalk" amino acids 272 to 311 (40 residues), 34.1 bits, see alignment (E = 4.5e-12) amino acids 364 to 406 (43 residues), 27.6 bits, see alignment (E = 4.9e-10) amino acids 531 to 564 (34 residues), 14.2 bits, see alignment (E = 7.4e-06) amino acids 639 to 681 (43 residues), 34.1 bits, see alignment (E = 4.6e-12) amino acids 757 to 801 (45 residues), 24.6 bits, see alignment 4.1e-09 amino acids 862 to 898 (37 residues), 36.1 bits, see alignment (E = 1.1e-12) PF03895: YadA_anchor" amino acids 906 to 964 (59 residues), 57 bits, see alignment 2.5e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6038)

Predicted SEED Role

"surface protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T8A6 at UniProt or InterPro

Protein Sequence (964 amino acids)

>BPHYT_RS29940 hemagglutinin (Burkholderia phytofirmans PsJN)
MLSKSYKIEWRSTTRTCAAASEMAKNRGGRGVAGYGALVAAGTSLFGTLVMALPARAAGE
SPNPIMNAPVEWDAADLATVSQTPDSNLSRPKTLTLATVALTDPVPVTQFIAVSQFTTPA
LTTSASGGENAMAVGVGATAIDTNALAIGTSSGAARVNTTAVGAGAAALASNATVVGAGA
TSNYFAENGVAIGYNAAVQNVNALAIGTNVQTNAANSIAAGSGAFIAEAATKAIAFGSGA
TATAAGSVALGADSSADRANTVSVGSATLQRQIANVAAGTQGSDAVTVSQLKGMAGVLGG
GTDVAADGTIAKPVYKVGGRIYNDVGSALAAVVTTSTQASADSVQYDSTSHDSVTLGSAA
APVRLTNVRAANLAAGSSDAVNGAQLFATNQAVAQNTGSITNLDQRVTDNTTNISNLDQR
VTDNTTNISNLDQRVTDNTTNISNLDQRVTDNTTNISNLDQRVTDNTTSISNLDQRTTTI
EGDVSNITNQITNGEIGLVQQDQTSRNLTVAKDTDGARVDFTGTGGARELTGIAAGTTDA
SAVNLGQFKPMVAALGGGAQINADGSLTGPSYHVQGGTQTTVGDALGSLDNGLSTLQQSM
ETGGIGMVTQDPVSRVINVGAVTDGKLVNMAGTAGHRVITGVAAGAVSPASSDAVNGSQL
YAQAASTAVALGGGATVNADGSVSAPSYSVGGTVVNNVGSAITNLDGRVTQNSSDISGLQ
TTVGNLGGAVANAVQYDSSAHDRITLGGVAANAPKVQLTNLQDGTLSATSTDAVTGAQLW
NTNQTVSTLSQQINVVRNNQTTGSPYVAVNSSGTAAQAIGNGSVAIGGGSKASAPNSVAI
GEGSVADVTNTVSVGSSGSERRITNVAAGQGPTDAVNMQQFQGGLSDMARNAYSGTASAL
ALTSIPEVDATKNLAIGVGTAGYKGYQAVAVGLSARVTQSLKVKLGAGISSATTAVTAGA
AYQW