Protein Info for BPHYT_RS29400 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 32 to 50 (19 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 126 to 149 (24 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details amino acids 328 to 347 (20 residues), see Phobius details amino acids 353 to 373 (21 residues), see Phobius details amino acids 385 to 407 (23 residues), see Phobius details amino acids 420 to 439 (20 residues), see Phobius details PF07690: MFS_1" amino acids 40 to 404 (365 residues), 166.4 bits, see alignment E=4.5e-53

Best Hits

Swiss-Prot: 48% identical to NICT_PSEPK: Putative metabolite transport protein NicT (nicT) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5928)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TFE9 at UniProt or InterPro

Protein Sequence (445 amino acids)

>BPHYT_RS29400 MFS transporter (Burkholderia phytofirmans PsJN)
MSSYQPASSRPTAATAIGQPGAEEVERTYKKVFWRIVPFLMLCYVVAYLDRVNVGFAKLQ
MSQDLAFSETVFGLGAGVFFIGYFLFELPSNILMHKLGARIWIARIMITWGLLSAVFVFV
KTPMQFYILRFLLGLAEAGFYPGVILYLTYWFPSHRRAKIIAVFMSAIPVSGIFGNPLSG
WIMQTFHNSSGFAGWQWMFLIEAIPAIAIGIATILYLDNGISAAKWLNEREKRLLTDEIA
AAQPQEKTQKHSLGAVFRDPRTWWMSLIYFAFVTGQYGLTFWMPTLVKSTGVTGAFNIGL
LSAIPFLCAIVVMNLMGHSADKRRERRWHLIVPALFGAIGFTVAASFADNTVVSIAFLSL
AAAGVLTCAPLFWSLPTAFMSGATAAAGIAIINSIGNLAGFASPYMIGYLKDLTHSTQTG
MYVLAGMLVIGAVATWLTPARLVNR