Protein Info for BPHYT_RS28625 in Burkholderia phytofirmans PsJN

Annotation: major facilitator transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 27 to 45 (19 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 122 to 146 (25 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 324 to 343 (20 residues), see Phobius details amino acids 349 to 369 (21 residues), see Phobius details amino acids 379 to 403 (25 residues), see Phobius details amino acids 415 to 437 (23 residues), see Phobius details PF07690: MFS_1" amino acids 35 to 400 (366 residues), 165.3 bits, see alignment E=9.6e-53 amino acids 294 to 438 (145 residues), 35.4 bits, see alignment E=3.1e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5772)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TGE0 at UniProt or InterPro

Protein Sequence (443 amino acids)

>BPHYT_RS28625 major facilitator transporter (Burkholderia phytofirmans PsJN)
MQASRTTLIEPITIEPHAQARAIYRKVTWRLLPFLFVCYVFAYLDRANIGFAHLQFSRDI
GMSEAAFGLGVGLFYAGYMLFEVPSNLWLQRVGVRRTLLRIMVLWGLVSTGTAFVQTPTQ
FYIARVLLGAAEAGFFPGVILYFTYWFPSARRARITSIFMTAICVSGIISGPLSGLILHS
LSGVGDLKGWQWMFIIEGLPSAVAGLFAYVYLTDRPEDATWLSSAEKEFLIGELKREALA
KTERAQASIWVALREPKFWALTFAYFSVPWASIVVHIWAPSVIQKSGVTNFWHIGLLSAI
PYITGAIAMYLFGRSSDRMLERRWHFMVSALLAALGVVFLPYAANNLVLLMVLLCVATAG
YLGMLSLFWTIPPAYLSSTVAASGIGLISSLGQFGGISAPTAIGFASTHFGSNAIGLYAV
AIVSVLGGLAVVLCIPARAINER