Protein Info for BPHYT_RS28285 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 313 to 336 (24 residues), see Phobius details amino acids 348 to 369 (22 residues), see Phobius details amino acids 375 to 396 (22 residues), see Phobius details PF07690: MFS_1" amino acids 31 to 342 (312 residues), 117.8 bits, see alignment E=2.7e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5698)

Predicted SEED Role

"Sugar efflux transporter B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TFN6 at UniProt or InterPro

Protein Sequence (415 amino acids)

>BPHYT_RS28285 MFS transporter (Burkholderia phytofirmans PsJN)
MLIEDNLPASTASLDDGASSSLRSWLAVMAVAIGAFAFVTTEFLPVGLLPRVAADLGVLP
GTAGLMVTVPGVIAAISAPGLMLVAGRMDRRRVFLLLTALLLASNLISAFAPNFLCMLLG
RALLGAALGGFWTLATAASGRLVKPKDSARAMATILTGVTCATVIGVPLGTFIASFASWR
VSFMATGVLVAVALVAQFFFVPSLPSTAALRLRDLVALLRRPHPRRSMLMVALVFGAHFS
SYTYITPFLLHNANLDMSTITWLLLGFGIIGFFSNFAVSSTVTRNLKVSVGAMVSLLMFA
LVLLPLLQHSTIGVVALVLAWGISFGALPLCFSIWIQRATPDSPEAGSALFVSIIQVAIA
LGSLVGGVVVDHVGISADFLLGSGLALLGLAALASFGRGEQKVAAEAVACPACTE