Protein Info for BPHYT_RS28215 in Burkholderia phytofirmans PsJN

Annotation: D-ribose transporter ATP binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 PF00005: ABC_tran" amino acids 28 to 176 (149 residues), 97.2 bits, see alignment E=1.4e-31 amino acids 276 to 429 (154 residues), 81.9 bits, see alignment E=7.1e-27

Best Hits

Swiss-Prot: 96% identical to RBSA_PARXL: Ribose import ATP-binding protein RbsA (rbsA) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K10441, ribose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 100% identity to bpy:Bphyt_5684)

MetaCyc: 42% identical to ribose ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Predicted L-rhamnose ABC transporter, ATP-binding component" in subsystem L-rhamnose utilization

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TFM2 at UniProt or InterPro

Protein Sequence (509 amino acids)

>BPHYT_RS28215 D-ribose transporter ATP binding protein (Burkholderia phytofirmans PsJN)
MQQPTSAVPRLELRHASKSFGRVRALSDGDLALWPGEVHALLGENGAGKSTVVKILAGVH
QPDTGELVVDGEARRFATPAEARDAGLAVIYQEPTLFFDLSIAENIFMGRQPVDRIGRIQ
YDAMRREVDGLLASLGVDLRADQLVRGLSIADQQVIEIAKALSLNANVLIMDEPTAALSL
PEVERLFTIVRKLRERDVAILFITHRLDEVFALTQRVTIMRDGAKVFDGLTTDLNTEAIV
AKMVGRDLETFYPKAERPPGEVRLSVRGLTRVGVFKDISFDVRAGEIVALAGLVGAGRSE
VARAIFGIDPLDSGEIWIAGKRLTAGRPAAAVRAGLALVPEDRRQQGLALELSIARNASM
TVLGRLVKHGLISARSETQLANQWGTRLRLKAGDPNAPVGTLSGGNQQKVVLGKWLATGP
KVLIIDEPTRGIDVGAKAEVYSALAELVRDGMAVLMISSELPEVLGMADRVLVMHEGRIS
ADIARADADEERIMGAALGQPMPPLGHAA