Protein Info for BPHYT_RS27950 in Burkholderia phytofirmans PsJN

Annotation: dihydroxyacetone kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02365: dihydroxyacetone kinase, L subunit
  • amino acids 8 to 202 (195 residues), 170.3 bits, E=2.1e-54
• PF02734: Dak2
  • amino acids 31 to 201 (171 residues), 145.1 bits, E=1e-46

Best Hits

KEGG orthology group: K05879, dihydroxyacetone kinase, C-terminal domain [EC: 2.7.1.-] (inferred from 100% identity to bpy:Bphyt_5632)

Predicted SEED Role

"Phosphoenolpyruvate-dihydroxyacetone phosphotransferase (EC 2.7.1.121), ADP-binding subunit DhaL" in subsystem Dihydroxyacetone kinases (EC 2.7.1.121)

MetaCyc Pathways

• glycerol degradation V (1/2 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-, 2.7.1.121

Use Curated BLAST to search for 2.7.1.- or 2.7.1.121

Sequence Analysis Tools

See B2TFH1 at UniProt or InterPro

Protein Sequence (210 amino acids)

>BPHYT_RS27950 dihydroxyacetone kinase (Burkholderia phytofirmans PsJN)
MNGKTVMACIDAAYAALKEHTDEIASLDQQIGDGDHIFNLLRGMEALLAVRAEIEAEAFG
PALDIAASKVLSTVGGSSGPLFFSLLNGMAKASAINAMDVAGFAHIFAAGVEAVGQRGKT
GVGSKTMMDVLIPVAKRFEELAAESAAARVVLDTLPQIAEENMLATRDMLATKGRASFLG
ERSRGHIDPGARSSQIMIASVCARLAQYNG