Protein Info for BPHYT_RS27920 in Burkholderia phytofirmans PsJN

Annotation: tricarballylate utilization protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 137 to 158 (22 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 288 to 310 (23 residues), see Phobius details amino acids 330 to 347 (18 residues), see Phobius details amino acids 354 to 374 (21 residues), see Phobius details TIGR02484: CitB domain protein" amino acids 38 to 398 (361 residues), 417.4 bits, see alignment E=2.9e-129

Best Hits

Swiss-Prot: 69% identical to CITB_SALTY: Citrate utilization protein B (citB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K13795, citrate/tricarballylate utilization protein (inferred from 100% identity to bpy:Bphyt_5625)

MetaCyc: 69% identical to FADH2:quinone oxidoreductase (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN-20072

Predicted SEED Role

"TcuB: works with TcuA to oxidize tricarballylate to cis-aconitate" in subsystem Tricarballylate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TG96 at UniProt or InterPro

Protein Sequence (404 amino acids)

>BPHYT_RS27920 tricarballylate utilization protein B (Burkholderia phytofirmans PsJN)
MQQSDVLAPDRTRTASPGEANHTPHGRTARVISIVPMSRSETEVARQMQICNACRYCEGF
CAVFPAMTRRLEFGKADVNYLANLCHNCGACYHACQYAPPHEFGVNVPKAMAEVRLETYT
EYAFPASFGALYKRNGLTLSVALSAGLALFLLLGTALHGRLSGDVAPANFYAIFPHNLLA
AMFGIVFLFAILALGVGVTRFWRDVAAGTTSASAPAVAEAVKNALTLKYLDGGHGDGCNE
NNDAFTLARRRFHHLTFYGFVLCFAATAVATVYHYAFKLEAPYPLFSVPVLLGTAGGIGL
IVGPAGLLWLNLNRVPERGDARQRPMDRGFIALLLLTSASGLALLAFRTTSAMPSLLAVH
LGIVMALFATLPYGKFAHGVFRSAALLKSSIERRQHNTLSVGSD