Protein Info for BPHYT_RS27610 in Burkholderia phytofirmans PsJN

Annotation: F0F1 ATP synthase subunit epsilon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02823: ATP-synt_DE_N
  • amino acids 6 to 87 (82 residues), 58.4 bits, E=2.8e-20
• TIGR03166: alternate F1F0 ATPase, F1 subunit epsilon
  • amino acids 8 to 128 (121 residues), 126.2 bits, E=3.3e-41

Best Hits

Swiss-Prot: 55% identical to ATPE2_PARXL: ATP synthase epsilon chain 2 (atpC2) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K02114, F-type H+-transporting ATPase subunit epsilon [EC: 3.6.3.14] (inferred from 100% identity to bpy:Bphyt_5559)

Predicted SEED Role

"ATP synthase epsilon chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

See B2TG39 at UniProt or InterPro

Protein Sequence (152 amino acids)

>BPHYT_RS27610 F0F1 ATP synthase subunit epsilon (Burkholderia phytofirmans PsJN)
MTGARLTLTLATPSRAWFDAVEIISLRAEDESGSFGIHVGHADFVTLLTPSVVRWICADG
VTRYCAVDGGVLLVSRGTQVSIACREAIPGDSLESLEEAVRRHHAVEDDAARRARVDQLR
LHARAVRQMLRYLCPRSGADGADDAATGVMPQ