Protein Info for BPHYT_RS27560 in Burkholderia phytofirmans PsJN

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 TIGR00229: PAS domain S-box protein" amino acids 20 to 141 (122 residues), 63.2 bits, see alignment E=1.3e-21 PF00989: PAS" amino acids 22 to 133 (112 residues), 39.3 bits, see alignment E=1.4e-13 PF13426: PAS_9" amino acids 34 to 136 (103 residues), 49.9 bits, see alignment E=8.3e-17 PF08448: PAS_4" amino acids 34 to 139 (106 residues), 44.6 bits, see alignment E=4e-15 PF07730: HisKA_3" amino acids 160 to 229 (70 residues), 42.8 bits, see alignment E=1.6e-14 PF02518: HATPase_c" amino acids 272 to 362 (91 residues), 54.8 bits, see alignment E=3e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5549)

Predicted SEED Role

"PAS/PAC sensor hybrid histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TG29 at UniProt or InterPro

Protein Sequence (370 amino acids)

>BPHYT_RS27560 histidine kinase (Burkholderia phytofirmans PsJN)
MQQDSPDWSTSRNLSDIDIEHRYRLLIEAVQDYAIFMLDAAGNVASWNLGAQRIKGYSPD
EIVGRHFSRFYTDEDIAAGKPAQLLATAAWQGRVEDEGWRVRKDESRLWANVVITAVHDE
QGDLLGFAKITRDMTERRRLEDLEHASAASALVQQARENEQRRIARELHDDLGQQITALK
MTLALHETELARHFSEAGRARLGSVREMADQLDAMATSMRRIAADLRPPMLDDLGLEAAL
EWMTEGFEQRYGVPVRCEISPDVLCLNDLAAISLYRVIQEALTNVARHARANEVFVTLSA
DDRHYHLQIHDDGVGLPKAPAPRADCFGLLGMRERISQLGGVLSVDSIPGRGVTITARVP
LARVLVESQP