Protein Info for BPHYT_RS27140 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 transmembrane" amino acids 66 to 89 (24 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 133 to 156 (24 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 194 to 217 (24 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details amino acids 326 to 350 (25 residues), see Phobius details amino acids 357 to 378 (22 residues), see Phobius details amino acids 389 to 410 (22 residues), see Phobius details amino acids 418 to 442 (25 residues), see Phobius details amino acids 457 to 481 (25 residues), see Phobius details amino acids 493 to 516 (24 residues), see Phobius details PF07690: MFS_1" amino acids 71 to 470 (400 residues), 166.5 bits, see alignment E=8.4e-53 amino acids 333 to 516 (184 residues), 39.5 bits, see alignment E=3.5e-14 PF00083: Sugar_tr" amino acids 77 to 247 (171 residues), 43.5 bits, see alignment E=2.1e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5462)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TE19 at UniProt or InterPro

Protein Sequence (528 amino acids)

>BPHYT_RS27140 MFS transporter (Burkholderia phytofirmans PsJN)
MKSEAIKSAPAASVGAQGAAASAVICPGSAAANLATGVAMGVAKGHAKGAAPSADNARPR
FERQGLALAVLFVGAFLAPLDYFIVNLALPSIHTGLNATDAQLQLVVSAYASAYAVLLIT
GGRLGDLFGRRRMFMTGMAAFVVASALCGFATSGHMLVISRIVQGIAAAVMAPQVLATIR
AVVPLHQQTKVMSLYGFVFGLSSIVGQLGGGALITYHPFGLDWRIIFLINIPIGIAAFVG
TWKFVPENQPATRTGIDVKGVALLSAVLLLVIYPMTHGREAGWPAWTFVMFALAVPAFAL
FVTTEQRVERGGGHPLVDLQLFRNRAFALGLVLAFLFYCNSAFFLTYGIFLQTGLHWTPL
ASGMAIMPFAIGFVVGPLTSPAVVKRIGGHVLTLGFSMMTVGFTVTGWSATQSATPDLLF
YCGLVCAGVGHGLLLPSIMRIVLLEVVPEKAGLASGVVSSTLQIGSAFGTAAISGAFFGA
IGARATSGDYAHAFQISLAINAALMFVCIGLSVLLVRHQQLQAVARAQ