Protein Info for BPHYT_RS26870 in Burkholderia phytofirmans PsJN

Annotation: cytochrome C551

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 36 to 55 (20 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 140 to 165 (26 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 3 to 205 (203 residues), 96.9 bits, see alignment E=6.4e-32 PF01545: Cation_efflux" amino acids 6 to 199 (194 residues), 96.9 bits, see alignment E=6.8e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5408)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBW8 at UniProt or InterPro

Protein Sequence (222 amino acids)

>BPHYT_RS26870 cytochrome C551 (Burkholderia phytofirmans PsJN)
MFKAATASALLNAFLSAMQIAIGLMAHSDGLFADGVHSLSDLAADGVVLIVLYLATRHPR
AAETSTDTGIEQALATLFIAAVLMITAAEMLWTSVAQTSTLSGGTAMHIGALAVSGFVML
AKEALFRFMRAEGARTGSAILLASAWHARVDAVSALVATLGLAGSLAGMPMLDHIAGAAI
GLMIMRMGYMSGRGALKQLFAGSPGNATAAATATATAGQPAE