Protein Info for BPHYT_RS26860 in Burkholderia phytofirmans PsJN

Annotation: major facilitator transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 229 to 246 (18 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details amino acids 294 to 316 (23 residues), see Phobius details amino acids 329 to 352 (24 residues), see Phobius details amino acids 358 to 384 (27 residues), see Phobius details amino acids 396 to 419 (24 residues), see Phobius details amino acids 437 to 458 (22 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 409 (391 residues), 155.8 bits, see alignment E=7.3e-50

Best Hits

Swiss-Prot: 35% identical to HSRA_ECOLI: Probable transport protein HsrA (hsrA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5406)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBW6 at UniProt or InterPro

Protein Sequence (479 amino acids)

>BPHYT_RS26860 major facilitator transporter (Burkholderia phytofirmans PsJN)
MSGSETRNAHVGWLPYIVAATFFMEYLDTTVIATALPQMAHSFGVGPNSLSLGMTAYMLA
LAIFIPASGWVADRCGSRTVFFSAIGVFTVASVLCGLSQNVAEFTAARLLQGIGGAMMVP
VGRLIVVRSTEKSRMMQAISTITWPAIAAPVVGPPIGGFITTYASWRWIFLLNVPFGLAA
MAVALALVPNLRGAERKPLDVIGLLLSGVALTAILYGAELASQPGENPWIAGAIVLGGLL
VGVVAFQHAKRHQHPLIDVSTLKIPTFSVTVVTGSFTRIGIGAVPYLMPLLFQVGFGLSA
FKSGLLLLASALGNLGMKALTTRILQRYGFRMVSIVDVTVAGVFIIACGLLSPNVPLALV
LFVVFIYGVARSMQFSTLATLAYADVAQPQMSAASTLWSAAAQMTIGLGIAFGAVSLRAA
AFFNGEVTGRVFTLDDFRLAFLFAGIVTLASVIGYMGLARDAGQSIGGGSRGSEDPAKG