Protein Info for BPHYT_RS26855 in Burkholderia phytofirmans PsJN

Annotation: carboxyvinyl-carboxyphosphonate phosphorylmutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 44% identical to DML_EUBBA: 2,3-dimethylmalate lyase (Dml) from Eubacterium barkeri

KEGG orthology group: K01003, carboxyvinyl-carboxyphosphonate phosphorylmutase [EC: 2.7.8.23] (inferred from 99% identity to bxe:Bxe_B1203)

MetaCyc: 44% identical to 2,3-dimethylmalate lyase subunit (Eubacterium barkeri)
2,3-dimethylmalate lyase. [EC: 4.1.3.32]

Predicted SEED Role

"Methylisocitrate lyase (EC 4.1.3.30)" in subsystem Methylcitrate cycle or Propionate-CoA to Succinate Module (EC 4.1.3.30)

MetaCyc Pathways

2-methylcitrate cycle I (5/5 steps found)
2-methylcitrate cycle II (5/6 steps found)
nicotinate degradation III (3/9 steps found)
superpathway of nicotinate degradation (5/18 steps found)
phosalacine biosynthesis (6/25 steps found)
phosphinothricin tripeptide biosynthesis (6/25 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.23 or 4.1.3.30 or 4.1.3.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBW5 at UniProt or InterPro

Protein Sequence (293 amino acids)

>BPHYT_RS26855 carboxyvinyl-carboxyphosphonate phosphorylmutase (Burkholderia phytofirmans PsJN)
MSTSATRRAAFRAKVNERQGLLVPGAFNAMSARVIEDAGFEAIYITGAGVTNMSLGLPDL
GFIGLAEVAEHTARIRDAVALPLIVDADTGFGNALNVRQTVRVLERSGADVIQFEDQIMP
KKCGHFSGKEVVSASEMVGKIRAAVDAREDGNLQIMARTDAAAVHGIEDAIERGHRFIEA
GADILFIEATESLADIERLPGLFDKPQLINIVIGGKTPVQSREALAKLGYGIVLYANAAL
QGAVLGMQRALGTLKTNGRLDEDATLVAPFSERQRLVNKPLYDKLDREYAAKE