Protein Info for BPHYT_RS26430 in Burkholderia phytofirmans PsJN

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 175 to 198 (24 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 212 to 375 (164 residues), 146.1 bits, see alignment E=4.1e-47 PF00990: GGDEF" amino acids 215 to 372 (158 residues), 144.6 bits, see alignment E=1.1e-46

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5319)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBM6 at UniProt or InterPro

Protein Sequence (381 amino acids)

>BPHYT_RS26430 diguanylate cyclase (Burkholderia phytofirmans PsJN)
MATQIGKTSTPIRERRRAGRGGPTGALVSPFRRAPALLAGASLLCLLVGLLYLASQIRTI
FSDQLKQEYAGLVLEAAERAESARAMVGVWQQQAGDGQAQTQAYRHARMELADRLKSLAA
LVNASPLAAPRMPASALTPDASLNGIDALLATIPPYWRAQRDADGADVRLRIAHVANVLI
ALAALLFCMLLTALGMYAKRNRQLAGESYEFEYAALHDSLTGLPNRRNLFAMLDEVAANL
HAAPMSRKIAVLYVDLDGFKQVNDTLGHRVGDEFLIAVSRAFRESVRKVDVVARIGGDEF
AVLIREYSTPDELAEIAQRLIACVVETDTEMGIGVVRASIGIASYPDLVSDYQRLVAAAD
DAMYHVKRGGKNGYAFAAQAD