Protein Info for BPHYT_RS26390 in Burkholderia phytofirmans PsJN

Annotation: antibiotic resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 77 to 92 (16 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 193 to 217 (25 residues), see Phobius details TIGR00427: membrane protein, MarC family" amino acids 9 to 209 (201 residues), 122.6 bits, see alignment E=9.2e-40 PF01914: MarC" amino acids 9 to 213 (205 residues), 127.4 bits, see alignment E=2.7e-41

Best Hits

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 100% identity to bpy:Bphyt_5311)

Predicted SEED Role

"Multiple antibiotic resistance protein marC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBL8 at UniProt or InterPro

Protein Sequence (225 amino acids)

>BPHYT_RS26390 antibiotic resistance protein (Burkholderia phytofirmans PsJN)
MVESLISDILFGFTGLISIINPIGIAFVFLDRTASLTTEERTALARKIAINVMCVLLVAF
FIGTPILHFFGISMQALRIGGGLAVAVGGWQMLNAPDTQPAEKPAVKRVDADNAMSKAFF
PFTIPLTTGPGSIATAVALTANRTHKLSEFVISSIASVVISVTVAVTVYLVYSRAVVFAK
YLGVEGTKVAMRVSSFLLLCIGVQIMLTGFSEFLIPIATMQPVVK