Protein Info for BPHYT_RS26075 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 254 to 278 (25 residues), see Phobius details amino acids 298 to 321 (24 residues), see Phobius details amino acids 332 to 357 (26 residues), see Phobius details PF02653: BPD_transp_2" amino acids 68 to 350 (283 residues), 110.5 bits, see alignment E=4.2e-36

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to bpy:Bphyt_5247)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, substrate-binding component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TD95 at UniProt or InterPro

Protein Sequence (363 amino acids)

>BPHYT_RS26075 ABC transporter permease (Burkholderia phytofirmans PsJN)
MTTLSSPFSRAGWRGSRRMRTAAVLSGAALVAIVAAMALIAIVHVPLGDAMAAFADGAWG
SPYAIGASINRSLVFALVGSGFVLANRAQLTNVGGEGQIAMGGIAATAVSLYGHVAHLPL
GLPFVVPMLGAALAGAAWGAIPGWLKARAGTNEVISTLLLTFIAVWFLYWCVQSEALLRQ
PMSNAATLPESLDIPDSTRLPLLASSSSTGLHIGLPITVVLCIAVALVLVYSRFGMHLRA
VGLNALAARRAGMPITSTIVGALALAGALGGLAGALMLQGDQYSLKAGFSSGYGFDGLVV
GLLARGSITGVCAAALLFGFLRSGGINMEMVASVPSALVLVVQGIVIVALAGGSLWLEPK
GAR