Protein Info for BPHYT_RS26045 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 64 to 85 (22 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 220 to 236 (17 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 269 to 287 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 15 to 286 (272 residues), 104.8 bits, see alignment E=2.4e-34

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to bpy:Bphyt_5241)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TD89 at UniProt or InterPro

Protein Sequence (305 amino acids)

>BPHYT_RS26045 ABC transporter permease (Burkholderia phytofirmans PsJN)
MHSPIVILLLSLFAGAIRVSTPYLFVSLGECLTEKGGRVNLGLEGILVSGAMSGYAGAFL
SGSPWIGVLAAGSVGLLLGCLHGLVCSLPRVSDIAFGIALMLLGTGLAFYLGKPFIEPQA
PMLPFIDLGAWSSSPQLHNALHLNLLFVIGVALAFVLQWGLRNTRWGMVLRLVGDHAETA
RAMGYPLTRVRIAATAVGGVFAGVGGAYLSLVYPGSWNEGLSSGQGLMAVALVIFARWQP
LRCLWAALLFGAAGALGPALQAIGVTSGYYLYNAAPYVLTLVIMIINCRPDRTLAGAPGE
LSLTR