Protein Info for BPHYT_RS25880 in Burkholderia phytofirmans PsJN

Annotation: type III secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details amino acids 81 to 109 (29 residues), see Phobius details amino acids 137 to 165 (29 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details PF01312: Bac_export_2" amino acids 3 to 246 (244 residues), 177.4 bits, see alignment E=2.3e-56

Best Hits

KEGG orthology group: K03229, type III secretion protein SctU (inferred from 100% identity to bpy:Bphyt_5209)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCZ4 at UniProt or InterPro

Protein Sequence (246 amino acids)

>BPHYT_RS25880 type III secretion protein (Burkholderia phytofirmans PsJN)
MSDKTEAPTPNRLRRARKDGDIAKSTHVSVAVSGLFWLLFLLMDAPHVYQVCVHVVEVAT
QIDQGQPFAVRYLQITRAFGAAMPILLATLGVGALAVVVPEVAQAGGVFAVKRALPDFKR
LNPVTGLKNLFGLKTLIDTGIVLMQFCILVFVLWHAFATWCAQLLPAFALAFGGQLSVTA
QSLAQLQGLMAASQLAPAAIDFWLQRLQWRRRLRMDKNEIKREHRDEDGDPHVKGRRRAL
HRELSR