Protein Info for BPHYT_RS25825 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 68 to 85 (18 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 183 to 206 (24 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 272 to 299 (28 residues), see Phobius details amino acids 306 to 330 (25 residues), see Phobius details PF02653: BPD_transp_2" amino acids 62 to 328 (267 residues), 158.3 bits, see alignment E=1.1e-50

Best Hits

Swiss-Prot: 41% identical to RBSC_ECOLI: Ribose import permease protein RbsC (rbsC) from Escherichia coli (strain K12)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to bpy:Bphyt_5198)

MetaCyc: 41% identical to ribose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCY3 at UniProt or InterPro

Protein Sequence (333 amino acids)

>BPHYT_RS25825 ABC transporter permease (Burkholderia phytofirmans PsJN)
MNESVSPLTAERQASPLQKSRMRRIAQALLQGDRPYALYAAFAILLVVFSFASPWFLSID
NFLNIGRQTALVSIIAIGMTFVIIARQIDLSVGSTLALSGMSAALAMAYVGNNWVIGAIA
GIGTGAIVGAINGIVTTRVNIPSFLVTLGTLSAARGLALMVTTTKPVIIDNDSFISIFGE
GDIFGVPVPIIWTLLAVIAGILLLHYSVFGRQIYAAGGNPTAALYSGINTRRVTTLAFIL
TGMLAGLAALVLSARSHAARPDVVQGMELDVIASVTLGGCSLFGGRGFVLGTLLGSLIIG
TLNNGLVLLGVSSSLQLVIKGVIIVAAVAFTRK