Protein Info for BPHYT_RS25535 in Burkholderia phytofirmans PsJN

Annotation: cytochrome C biogenesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 43 to 66 (24 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 121 to 145 (25 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details PF02683: DsbD" amino acids 12 to 217 (206 residues), 68 bits, see alignment E=1.1e-22 PF13386: DsbD_2" amino acids 31 to 212 (182 residues), 37.7 bits, see alignment E=2.1e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5137)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcdA (DsbD analog)" in subsystem Biogenesis of c-type cytochromes or Experimental tye or Periplasmic disulfide interchange or Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCS4 at UniProt or InterPro

Protein Sequence (242 amino acids)

>BPHYT_RS25535 cytochrome C biogenesis protein (Burkholderia phytofirmans PsJN)
MQFTAATYGLSLVAGSASVLSPCVLPLLPILATSALAKHRFGVIALAAGLAISFAGVGIF
LATLGASAGLDPEILRRWAASLMLFFGLVMLSGTLQRAFSRLSSVIGAKGQQALDDVKGN
GLLGQAMIGLLLGFVWTPCVGPTLGAATSLAAQGQDLGHIAIVMALFGLGAALPLVLLGT
ISRVSLTKVRGTLAAWGKTARWTLGALFVVMGTIVITGVDRQLETLLLSVSPAWLTTLTT
SL