Protein Info for BPHYT_RS25490 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF05114: DUF692" amino acids 27 to 291 (265 residues), 350.4 bits, see alignment E=2.9e-109

Best Hits

Swiss-Prot: 100% identical to Y5128_PARPJ: UPF0276 protein Bphyt_5128 (Bphyt_5128) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K09930, hypothetical protein (inferred from 100% identity to bpy:Bphyt_5128)

Predicted SEED Role

"Uncharacterized protein conserved in bacteria, NMA0228-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCR1 at UniProt or InterPro

Protein Sequence (307 amino acids)

>BPHYT_RS25490 hypothetical protein (Burkholderia phytofirmans PsJN)
MNDTSRTTAVCEPGCSNGVTRRAQAPVGTSFKHEHLSSILADGLKDGFFEVHAENYMGAG
GPPHRALAAIREAYPISLHGVCMSIGGPGALDLTHLSRFRDLVTRYEPVLVSEHLAWSSH
GGTFFNDLLPLPYTKATLEHVCEHISQVQDAIKRPLLLENPSTYVAFASSTLSETEFIRA
VVQHTGCGLLLDLNNVFVSATNHGFSAEAYLEGLPLEQVGEIHLAGHSEQRDDENELLLI
DSHDCAISDPVWHLYRDLVARIGPTPTLIEWDSKLPAWPVLRAQALSARHITAEEDVSLA
EEVSHAG