Protein Info for BPHYT_RS25060 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 80 to 99 (20 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 290 to 313 (24 residues), see Phobius details amino acids 319 to 342 (24 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details PF01988: VIT1" amino acids 158 to 369 (212 residues), 228.5 bits, see alignment E=4.3e-72

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5039)

Predicted SEED Role

"nodulin 21-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCH9 at UniProt or InterPro

Protein Sequence (376 amino acids)

>BPHYT_RS25060 membrane protein (Burkholderia phytofirmans PsJN)
MASRREVERYKANLSDELHSAALYETLAKVEQDGARKQVYSELARSERDHAQVWADKLRA
NGLDPKGTGQAVKTRLMKGLVRLFGAGFVLPTLAAAEYADRNKYQGQPDAGRMSADEHHH
AAMVQALAHGGGDASLAPGARIAAAESWHKGAGSGNDLRAAVLGANDGLVSNFCLIMGVA
GAGTGNKAILLTGLAGLIAGACSMALGEWLSVTNARELASTQVAKEAQELEESPEAEEHE
LALIYRAKGLDAGEAKRVASQMMRDKSKALDTLTREELGLDPAELGGNPWSAAGVSFCLF
SVGAIFPVMPFLWTHGYSAIMQCVVLSMLALASIGVFTSLFNGRSAGFSALRQVVIGLIA
AAFTFGVGRLLGVSVS