Protein Info for BPHYT_RS25055 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 18 to 40 (23 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 247 to 269 (23 residues), see Phobius details amino acids 276 to 298 (23 residues), see Phobius details amino acids 310 to 328 (19 residues), see Phobius details amino acids 334 to 353 (20 residues), see Phobius details amino acids 364 to 388 (25 residues), see Phobius details amino acids 397 to 419 (23 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 385 (365 residues), 159 bits, see alignment E=7.6e-51

Best Hits

Swiss-Prot: 66% identical to TUB3_AGRVI: Putative tartrate transporter (ttuB) from Agrobacterium vitis

KEGG orthology group: K13021, MFS transporter, ACS family, tartrate transporter (inferred from 100% identity to bpy:Bphyt_5038)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCH8 at UniProt or InterPro

Protein Sequence (431 amino acids)

>BPHYT_RS25055 MFS transporter (Burkholderia phytofirmans PsJN)
MNNELQARVVRKLTWRILPFVMLLYFVSFLDRVNVGFAAITMNKDLGLTPTMFGLGGGIF
FLGYFLFEVPSNLILNKVGARIWIARVMVTWGLVSAASAFVAGPTSFYTLRFLLGVAEAG
FFPGIILYLSQWFPARQRAVAAAAFMAAAPLSTAIGSPISGAIMQMPALFGLKDWQWLFV
IEAIPAVLLGFVVLKALTDSPDKAKWLAADEKAWLIATLRDERMGRESQAGHAAGALAAL
RDSRVWIMSMIYFGTSAGLYTLGLWAPLIIRQFGFSALGTGALNAIPSVLAVLGMVVWAR
HSDRRGERTWHVVIPCVAAAIGLAWAGLADTAVGVVLALVVVNVGISAAKAPLWAMPSTF
LSGAGAAAGIAMINSIGNLGGFVGPFAIGWLKSVTGGYAAGLYVVAASLAVSALLTLAVG
RRGYRTAHAAQ