Protein Info for BPHYT_RS24670 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 44 to 67 (24 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 132 to 156 (25 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 231 to 260 (30 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 112 to 309 (198 residues), 58 bits, see alignment E=5.5e-20

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to bpy:Bphyt_4967)

Predicted SEED Role

"ABC spermidine/putrescine transporter, inner membrane subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCA7 at UniProt or InterPro

Protein Sequence (319 amino acids)

>BPHYT_RS24670 ABC transporter permease (Burkholderia phytofirmans PsJN)
MTTMLARFSRRVASSGPASDAASGASGLGPDTPAATAMAKARPWLLLAPILLFLAILGAA
ALVVLRMSFGTQGNEWHGFTLQNYADLLDGYFMKSLWLTLKLAFQSMICAVLLAIPVALA
MARTKSRLARRLLLAGVLLPLLVNLLLQGYGWLIILGPAGLLNHALLGSGLVQRPLMWLY
RENGVLLGLIQTAFPLAVLPLSSAMRAVSSSYEEAAATLGATRWQTLRHVLLPLAMPGLV
SGALLVFAYNASAFAVPLLLGGRRVPMLAVLVHDQVAPLLNWPAASASGVVLMIATLTVM
ALSQRLVRRTQKLAEEPHA