Protein Info for BPHYT_RS24425 in Burkholderia phytofirmans PsJN

Annotation: ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 891 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 12 to 879 (868 residues), 1297.1 bits, see alignment E=0 PF02861: Clp_N" amino acids 28 to 74 (47 residues), 29.6 bits, see alignment 2.9e-10 PF00004: AAA" amino acids 233 to 363 (131 residues), 37.2 bits, see alignment E=1.7e-12 amino acids 626 to 744 (119 residues), 28.8 bits, see alignment E=6.7e-10 PF17871: AAA_lid_9" amino acids 373 to 471 (99 residues), 103.2 bits, see alignment E=3e-33 PF07724: AAA_2" amino acids 621 to 789 (169 residues), 190.9 bits, see alignment E=8.2e-60 PF07728: AAA_5" amino acids 626 to 746 (121 residues), 40.5 bits, see alignment E=1.3e-13 PF10431: ClpB_D2-small" amino acids 796 to 867 (72 residues), 42.1 bits, see alignment E=3.2e-14

Best Hits

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 100% identity to bpy:Bphyt_4919)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TC63 at UniProt or InterPro

Protein Sequence (891 amino acids)

>BPHYT_RS24425 ATPase (Burkholderia phytofirmans PsJN)
MSTSLNTLIAKLNPTCRQAALLAANNCLARGHYEVDLEHLLLPLLDEPASDVALVLRASR
IDPHALRADLERELQRLKTGNTRTPVFSKHLIELLEQAWLIASLDSQIGRIRSGHLLLAL
LSAPDLAQFAERMSPLLRDVRVTDLKHKFDELTAGSREVEHSNDTQSAGDSASDPVASAV
APGAPSKTPALDTYTSNLTQRAREGKIDPVIGREGEIRQAIDILMRRRQNNPIMTGEAGV
GKTAVVEGLALRIAADDVPAPLKGVALHVLDMGLLQAGASVKGEFENRLKNVIDEVKKSP
HPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKKYFEKDAALA
RRFQVVKIEEPSEALAAAMLRGMASLMEKHFNVRVLDDAITEAVRLSHRYISGRQLPDKA
ISVLDTACAKVALAHSSTPATIDDTKKRLERIDAEIAALEREAASGALHDERLAELRGLR
EEDLKDLAADEARYDKERVLVTEIVGLRADIDAARVNSAGPEQADKAQQAREKLAARVAE
LHALQGGQPMVPLQVDAHVVAEIVASWTGIPLGRMVKDEIQTVLNLQPLLAARVIGQDHA
LEAIAQRVRTASANLEDPNKPRGVFMFVGPSGVGKTETALALADVLYGGERKMVTINMSE
YQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLDEVEKAHPEVLEMFFQVFDK
GTMDDAEGREIDFRNTLIILTSNVGSQAVMQACLNKSAEELPDADELAETLRLQLYKAFK
PAFLGRMKVVPYYPISDDVLAEIIELKLDRIRRRIESNHKAVFEWDESLVDAVLARCTEV
DSGARNVDHILNGTLLPEVAQQVLERVANGAAIERIAVRASEAGEFDYTVV