Protein Info for BPHYT_RS24010 in Burkholderia phytofirmans PsJN

Updated annotation (from data): L-histidine ABC transporter, permease component 2
Rationale: Specifically important for histidine utilization.
Original annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 17 to 45 (29 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 125 to 142 (18 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 118 (107 residues), 66.1 bits, see alignment E=1.6e-22 PF00528: BPD_transp_1" amino acids 43 to 224 (182 residues), 59.1 bits, see alignment E=2.5e-20

Best Hits

Swiss-Prot: 51% identical to NOCM_AGRFC: Nopaline transport system permease protein NocM (nocM) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K10019, octopine/nopaline transport system permease protein (inferred from 100% identity to bpy:Bphyt_4836)

Predicted SEED Role

"ABC-type arginine/histidine transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBJ8 at UniProt or InterPro

Protein Sequence (250 amino acids)

>BPHYT_RS24010 L-histidine ABC transporter, permease component 2 (Burkholderia phytofirmans PsJN)
MHFDFDFLFDTIKQLLAAVPTTLGLFFCSLILGGLLSLVIVTMRVSPHWLPNRFARAYIL
VFRGSPLLIQMFLVYYGMGQFGVIRESFLWPVLREPYMCAVLSLALCTAGYTAEIIRGGL
MAVPVGQIEAGYSIGLSGFALLRRVIGPIALRQCLPAYSTEAVLLVKSTALASLVTVWEV
TGVAQQIIQQTYRTTEVFICAALIYLFLNFVIVRLLGMLETRLSRHLRAARPAAVSRPVS
ATTEARRAAP