Protein Info for BPHYT_RS24005 in Burkholderia phytofirmans PsJN

Updated annotation (from data): L-histidine ABC transporter, permease component 1
Rationale: Specifically important for histidine utilization.
Original annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 transmembrane" amino acids 17 to 45 (29 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 91 to 92 (2 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 18 to 124 (107 residues), 58.9 bits, see alignment E=3e-20 PF00528: BPD_transp_1" amino acids 37 to 222 (186 residues), 52.8 bits, see alignment E=2.1e-18

Best Hits

Swiss-Prot: 53% identical to OCCQ_RHIML: Octopine transport system permease protein OccQ (occQ) from Rhizobium meliloti

KEGG orthology group: K10020, octopine/nopaline transport system permease protein (inferred from 100% identity to bpy:Bphyt_4835)

MetaCyc: 33% identical to L-arginine ABC transporter membrane subunit ArtQ (Escherichia coli K-12 substr. MG1655)
ABC-4-RXN [EC: 7.4.2.1]

Predicted SEED Role

"ABC-type arginine transport system, permease component"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBJ7 at UniProt or InterPro

Protein Sequence (240 amino acids)

>BPHYT_RS24005 L-histidine ABC transporter, permease component 1 (Burkholderia phytofirmans PsJN)
MALIQMLGFGPEGWGGVLLLAALMTVALTLAALAVGAVFGALVAAAKLSRFRTLRVIGDI
YTTVFRGVPELLVIYLFYFGGSTLVTSVGQLFGAEGFVGVPPFVVGALAVGMISGAYQAE
VYRSAVLAVSRGELEAARSIGMPTLTMARRILIPQVLRFALPGIGNVWQLSLKDSALISV
TGLAELLRTSQVAAGSTHQYFTFFVVGGALYLIMTSISNRVFNRAEAHVGRSFKRNFARN