Protein Info for BPHYT_RS23995 in Burkholderia phytofirmans PsJN

Annotation: isoprenylcysteine carboxyl methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 164 to 194 (31 residues), see Phobius details PF04140: ICMT" amino acids 117 to 203 (87 residues), 37.3 bits, see alignment E=3e-13 PF04191: PEMT" amino acids 143 to 204 (62 residues), 38.2 bits, see alignment E=1.7e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4833)

Predicted SEED Role

"Isoprenylcysteine carboxyl methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBJ5 at UniProt or InterPro

Protein Sequence (226 amino acids)

>BPHYT_RS23995 isoprenylcysteine carboxyl methyltransferase (Burkholderia phytofirmans PsJN)
MVARLIFQTVVWLVGMGALLFGAAGTFAWPAAWWYVIELGVLSLWIGLWLARHDPGLLAE
RLSPLLQAQQNRWDRIFMVSVSLAWCGWLVLMAFDAMRFHWSAPLPVALVSFGSLCVFLC
LFMCRFVFQANSYAAPVVKIQTSRGHKVVDTGLYAHVRHPMYSAALLLLVGTPLLLGSWW
GLAFVPVMVIAIGWRAVREERVLAAQLDGYTDYMARVRYRFVPFIW