Protein Info for BPHYT_RS23945 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 23 to 46 (24 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details amino acids 312 to 333 (22 residues), see Phobius details amino acids 339 to 361 (23 residues), see Phobius details amino acids 373 to 396 (24 residues), see Phobius details amino acids 402 to 423 (22 residues), see Phobius details PF07690: MFS_1" amino acids 35 to 251 (217 residues), 105.6 bits, see alignment E=2.7e-34 PF00083: Sugar_tr" amino acids 72 to 216 (145 residues), 72.1 bits, see alignment E=4.6e-24 amino acids 269 to 431 (163 residues), 33.3 bits, see alignment E=2.6e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4823)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBI5 at UniProt or InterPro

Protein Sequence (433 amino acids)

>BPHYT_RS23945 MFS transporter (Burkholderia phytofirmans PsJN)
MMNSLTDRTSVTRRRTPLNRSQIAGFWGAWAGWTLDGMDSFIYALVLTPALTELLPRSGY
AATPANVGLAGSILFALFLVGWGLSFIWGPLADRYGRTKVLAGTIFTFAIFTGLAATSHN
VWELGIYRFIAGVGIGGEWALAGTYVAEAWPEDRRKMGAGYLQTGYYAGFFLAAALNYTI
GVHYGWRAMFLTGAVPVVVAILILLRVKESEKWEKAEARTVRTKPLREILGPAYRRRTWV
ACILLTIAIIGLWAGAVYEPSAVIQLATKAGMAKNDAIRTASLATGLLSIATILGCLALP
PLAERIGRKKTLAIYFLGMAVAIVGSFGWAFYLPNGLAPFIAWLFVLGFFGGNFALFSLW
LPEQFETRVRATAFAFCTSFGRFVGAGVNFLLGAAVLHMHTLGVPVALTAIAFIVGLFVI
PFAPETRGEVLPQ