Protein Info for BPHYT_RS23880 in Burkholderia phytofirmans PsJN

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 16 to 33 (18 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 105 to 122 (18 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details amino acids 310 to 333 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 52 to 320 (269 residues), 119.7 bits, see alignment E=6.5e-39

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to bpy:Bphyt_4810)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBH2 at UniProt or InterPro

Protein Sequence (343 amino acids)

>BPHYT_RS23880 sugar ABC transporter permease (Burkholderia phytofirmans PsJN)
MKLSNWFVRDGAERPLIWPCVTLVLLCGLNLWVNPHFLSLRMLDGHLFGAPIDVLNRAAP
LVLVATGMTLVIATRGIDISVGAVVAIAGAAAATILAAQPEPSSALIAQALIAALIVGVL
SGMWNGVLVSFVGMQPIIATLILMVAGRGIAQLLTAGQIIPIGAPGYLFVGGGYLLGVPS
SVWIATVAVLATAALVEGTALGLFIRAIGVNPVATRLVGLRSKALVFAVYGFSGLTAAMA
GILISSNVRSADGNNAGLLLELDAILAVTLGGTSLLGGRFSLAGTVLGALIIQTLTYTTY
SIGVPPEATLVVKAAVVLAVSVIQSPSARALGMSLVTHRRVAR