Protein Info for BPHYT_RS23760 in Burkholderia phytofirmans PsJN

Annotation: phosphonate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 47 to 69 (23 residues), see Phobius details amino acids 99 to 123 (25 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 210 to 228 (19 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details TIGR03226: 2-aminoethylphosphonate ABC transporter, permease protein" amino acids 11 to 311 (301 residues), 436.4 bits, see alignment E=3.5e-135 PF00528: BPD_transp_1" amino acids 111 to 310 (200 residues), 69.8 bits, see alignment E=1.3e-23

Best Hits

Swiss-Prot: 39% identical to PHNU_SALPA: Putative 2-aminoethylphosphonate transport system permease protein PhnU (phnU) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K11083, 2-aminoethylphosphonate transport system permease protein (inferred from 100% identity to bpy:Bphyt_4791)

Predicted SEED Role

"2-aminoethylphosphonate ABC transporter permease protein I (TC 3.A.1.9.1)" in subsystem Phosphonate metabolism (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDW6 at UniProt or InterPro

Protein Sequence (318 amino acids)

>BPHYT_RS23760 phosphonate ABC transporter permease (Burkholderia phytofirmans PsJN)
MSSLSTPDTPNPLGSAAADAAADVRRSASAASHTAAVKRRERAAQWHLLFILVVVLGPLV
VYPLVRLVLLSLTGPHGLSLHAYSAFFSNPETSGVIGTTLWILFASAGLASLLGVALASI
LFFKPFPGARMITRFLELFVAFPSFLVAFTLIFLYGSQGSVSIGLQRLFHMQAPPLDFLF
GVGGVILAEVVFYAPFVVRPTLASFATLDMRLIEAARSLGASGWMVAFKVILPLAWPGIA
AGTILCFLLTLNEFGILLVLGSAHLITLPVAIYSSATVDLDLPTAAAGAVVMLIMSLSLY
ALYRQVNRRKVKGAGHGR