Protein Info for BPHYT_RS23720 in Burkholderia phytofirmans PsJN

Annotation: nH(3)-dependent NAD(+) synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to NADE_PARPJ: NH(3)-dependent NAD(+) synthetase (nadE) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K01916, NAD+ synthase [EC: 6.3.1.5] (inferred from 100% identity to bpy:Bphyt_4784)

MetaCyc: 49% identical to NH3-dependent NAD+ synthetase (Escherichia coli K-12 substr. MG1655)
NAD(+) synthase. [EC: 6.3.1.5]

Predicted SEED Role

"NAD synthetase (EC 6.3.1.5)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 6.3.1.5)

MetaCyc Pathways

aspartate superpathway (23/25 steps found)
NAD de novo biosynthesis I (6/6 steps found)
NAD de novo biosynthesis III (6/6 steps found)
NAD salvage pathway II (PNC IV cycle) (5/5 steps found)
NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
NAD salvage pathway I (PNC VI cycle) (5/7 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.5

Use Curated BLAST to search for 6.3.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDV9 at UniProt or InterPro

Protein Sequence (286 amino acids)

>BPHYT_RS23720 nH(3)-dependent NAD(+) synthetase (Burkholderia phytofirmans PsJN)
MTQHDPVARQASISEEMHISAEFDAEYEIERRVAFLANYLRSSGLKTYVLGISGGVDSTT
AGRLAQLAVERLRAEHYDAHFVAIRLPYGEQKDEADAQQALRFIRADENLTIDIKPAADA
MLAALDQSGLLYKDESQQDFVHGNIKARQRMIAQYAVASARAGVVIGTDHAAESVMGFFT
KFGDGGADVLPLTGLNKRRVRAVSKALGAPEALAHKVPTADLEMLRPQRPDEDAYGIPYD
AIDDFLERKPVSDAARETILRFHEVTRHKRALPYTPFDWPVQTSGD