Protein Info for BPHYT_RS23430 in Burkholderia phytofirmans PsJN

Annotation: bifunctional D-altronate/D-mannonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 PF02746: MR_MLE_N" amino acids 14 to 110 (97 residues), 107 bits, see alignment E=6.9e-35 PF13378: MR_MLE_C" amino acids 136 to 377 (242 residues), 155.4 bits, see alignment E=1.8e-49

Best Hits

Swiss-Prot: 78% identical to MAND_ESCAT: D-galactonate dehydratase family member RspA (rspA) from Escherichia albertii (strain TW07627)

KEGG orthology group: K08323, starvation sensing protein RspA (inferred from 100% identity to bpy:Bphyt_4722)

Predicted SEED Role

"Starvation sensing protein RspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDP8 at UniProt or InterPro

Protein Sequence (402 amino acids)

>BPHYT_RS23430 bifunctional D-altronate/D-mannonate dehydratase (Burkholderia phytofirmans PsJN)
MKIVRADVIVTCPGRNFVTLKIVTDEGVHGIGDATLNGRELAVASYLKDHVCPLLIGRDP
GCIEDTWQYLYKGAYWRRGPVTMTAIAAVDMALWDILGKVTGMPLYKLLGGASRESVMVY
GHATGRDIPEALDRYAEHIEAGYQAIRIQCGVPNMRSVYGVSKGSGMYEPATKGAVEEQS
WSSEKYLDFVPKLFEAVRDKFGFDTHLLHDVHHRLTPIEAARLGKSIEPYRLFWMEDPTP
AENQAGFRLIREHTVTPIAVGEVFNSIWDCKQLIEEQLIDYIRATLTHAGGITHLRRIAD
FASLYQVRTGCHGPSDLSPVCMGAALHFDLWVPNFGVQEYMGFPQEALDVFPHAWRFERG
TMHPGEAPGHGVDIDEAAAARYPYDPAYLPVARLEDGTLWNW