Protein Info for BPHYT_RS23360 in Burkholderia phytofirmans PsJN

Annotation: glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 12 to 173 (162 residues), 77.9 bits, see alignment E=2.9e-25 PF13579: Glyco_trans_4_4" amino acids 13 to 170 (158 residues), 68.5 bits, see alignment E=2.7e-22 PF20706: GT4-conflict" amino acids 177 to 345 (169 residues), 27.9 bits, see alignment E=3.6e-10 PF00534: Glycos_transf_1" amino acids 192 to 348 (157 residues), 122.9 bits, see alignment E=3.3e-39 PF13692: Glyco_trans_1_4" amino acids 194 to 335 (142 residues), 118.6 bits, see alignment E=8e-38 PF13524: Glyco_trans_1_2" amino acids 274 to 352 (79 residues), 38.3 bits, see alignment E=3.8e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4707)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDN3 at UniProt or InterPro

Protein Sequence (386 amino acids)

>BPHYT_RS23360 glycosyl transferase (Burkholderia phytofirmans PsJN)
MKILLFIHSLHYGGAERVAMNLSSEWAAQGQEVCVVTLTSTASDFYSLHDSVKRRTLDLA
GATNGLTGAVFANASRMLALRRVLKQERPDVVLGIETRPSILAILAGIGLPCKVIATEHI
HPPMLFEGRFWESLRRWTYPFADKVVALTEKSRLWLQEHCHCKSVTVIPNSISLPIPVVE
PLVSPHAVVGAQRRVLLAAGRMAEQKGFDILIDSFSRIASDFPAWDLVILGDGDDRGALT
AQVAAAGLEKRVLLPGQVGNMPDWYERADLYVLSSRFEGFSMTIVEAMASGCAVVSFDCD
AGPGDIITHGHDGLLVREVGDPQALAEALSTLMKDDETRALMASRARAVVERFSVARVFS
LWRDVFTQTGARPSGLVDRTSVRVTE