Protein Info for BPHYT_RS23355 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 61 to 85 (25 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 279 to 303 (25 residues), see Phobius details amino acids 324 to 345 (22 residues), see Phobius details amino acids 365 to 387 (23 residues), see Phobius details amino acids 394 to 413 (20 residues), see Phobius details amino acids 419 to 440 (22 residues), see Phobius details PF03023: MurJ" amino acids 46 to 435 (390 residues), 104.6 bits, see alignment E=7.8e-34 PF01554: MatE" amino acids 249 to 411 (163 residues), 37.5 bits, see alignment E=3e-13 PF14667: Polysacc_synt_C" amino acids 367 to 438 (72 residues), 28.7 bits, see alignment E=2e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4706)

Predicted SEED Role

"virulence factor MVIN family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDN2 at UniProt or InterPro

Protein Sequence (442 amino acids)

>BPHYT_RS23355 membrane protein (Burkholderia phytofirmans PsJN)
MSQIAGWRNRLAQIHPDHSRIARSAVWVSLFALIGKSAGALKEMSIAYRYGISNVVDAYQ
LTLTLITWLPATFVAVLSVVLVPALVELRSRPKQEQAKFLGELDVMAIVVGVAFTVLLYF
SWPYALDLMARNLSDETRVMSRRIMLGMAPVGIVMLTICVYAARLQAREKHVNTLLECVP
ALVLLCFVLAWHDAGSPAPLIWGSTLGFILQAVLLGVLAGRADQIRPRLSFSLSSPQWPH
MYRAVGVFMIGQFVMSLATPLDQYFVAGLGDGNIATLGYASRVLGLLVSMGAVAISRATL
PVLSELLSAGDNVRARSIALKWSLFMLAISGVVVVVAWLLAPFVVKLLFQRGAFSAADTV
AVSSLFRWGLIQIPFYFSVLVLVQLFASQGRFKAMAAIAVVNFAVKAVANFFLIRWFGIT
GVVLATGVMGASSFVCYLSLTL