Protein Info for BPHYT_RS23340 in Burkholderia phytofirmans PsJN

Annotation: sugar transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 747 transmembrane" amino acids 33 to 56 (24 residues), see Phobius details amino acids 450 to 469 (20 residues), see Phobius details PF02706: Wzz" amino acids 16 to 110 (95 residues), 50.4 bits, see alignment E=5.7e-17 TIGR01005: exopolysaccharide transport protein family" amino acids 22 to 740 (719 residues), 446 bits, see alignment E=2.4e-137 PF13807: GNVR" amino acids 393 to 471 (79 residues), 72.7 bits, see alignment E=4.9e-24 TIGR01007: capsular exopolysaccharide family" amino acids 529 to 733 (205 residues), 121.6 bits, see alignment E=3.2e-39 PF06564: CBP_BcsQ" amino acids 549 to 692 (144 residues), 21.8 bits, see alignment E=3.1e-08 PF01656: CbiA" amino acids 552 to 720 (169 residues), 27.7 bits, see alignment E=5.6e-10 PF13614: AAA_31" amino acids 558 to 686 (129 residues), 35.8 bits, see alignment E=2e-12

Best Hits

Swiss-Prot: 43% identical to EPSB_RALSO: Putative tyrosine-protein kinase EpsB (epsB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4703)

Predicted SEED Role

"Tyrosine-protein kinase Wzc (EC 2.7.10.2)" in subsystem Colanic acid biosynthesis (EC 2.7.10.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.10.2

Use Curated BLAST to search for 2.7.10.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDM9 at UniProt or InterPro

Protein Sequence (747 amino acids)

>BPHYT_RS23340 sugar transporter (Burkholderia phytofirmans PsJN)
MKLKYQASEGLSERNDEFDPGSIIDTLINHRKMIAAITMAFILVGALYAFCATPIYRASI
SIRVEDNSPTALPDSKDLVRNASSLFQEKSSAESEMQILRSKAIAMQTVDYLKLYIEAEP
KRLPVLGGLIARHTDSRMTPGIFGWGGFVWGDESISVSTFEVPRKQEGNAYTVTALTGGQ
YQLRGPGLEQPVTGRVGVDEQFETSHGPVNLLVSKIDGESGAEFKLTRHSRQQALEQLQK
GLQVDEQGNKSNVLGVMLEGRDPVLVTNILNDIGAVYVRQNVNEKGANAEKSLNYLEQQL
PGAKRQMEQAEEAYNTYRNSHGLLDADEESRLILRQATEADSRLYDLKRQRQDLMAHLTA
EHPSVVAIDQQIASTNKYVESLAARVKSMPTAEQGAIRLMRDMRMSSDMYSALRSNIDTL
RLVKAGQSASVQLLDTADVPERPVKPAKTLVLLISAVLGLFVAIGLAFLRDYLFKGESDP
EELESRTGLTVYATIPVSDQQEQLTQKMAIRGPEKLALAFRYPMDPAVEALRTMRAALQF
ALNGDRNNVVMLAGPLPGIGKSFLSANLGTLLASGGKRVLLVDGDLRRGHLNQYFGLQRG
AGLADLITGERSLEDTVHKEVLPNLDVLQCGEYPHDPAELLLSANFRATIRAASEQYDIV
LLDAPAILAVSDTVTMAPVADSIFMVARFADTRAGEISESVKRLAQTGSKVEGILLNGFK
VSRGNYAQSRRYGGYAYDAYYSDSVTK