Protein Info for BPHYT_RS23230 in Burkholderia phytofirmans PsJN

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 657 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 127 to 143 (17 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 172 to 195 (24 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 224 to 382 (159 residues), 96.8 bits, see alignment E=5.7e-32 PF00990: GGDEF" amino acids 225 to 380 (156 residues), 119.3 bits, see alignment E=1.4e-38 PF00563: EAL" amino acids 402 to 633 (232 residues), 226.9 bits, see alignment E=2.5e-71

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4680)

Predicted SEED Role

"Predicted signal transduction protein containing a membrane domain, an EAL and a GGDEF domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDK0 at UniProt or InterPro

Protein Sequence (657 amino acids)

>BPHYT_RS23230 histidine kinase (Burkholderia phytofirmans PsJN)
MILLVKLREALSVAERDPELVRSQLEAFGHQVPLLYFILLVNTAAVAITHVNCAPAWLSI
YFPATLCALCIIRCIRWWRLRHRVLTLDKAVPEVRKLTWLAGLFAVAFSAWSLFLFPYGT
AYEQTQVAFYMATTLVGCVFCLMHLRAAAMLLLSIVILSFSIFLVFTGYPVFIAMAVDMT
LVGIALAFIIQLYCRTFADVVHAQRELQASQQKTQRLSDDNFRLASIDSLTDLPNRRSFF
ASLRALSEQAIGTSGGFNVGLIDLDGFKQVNDIYGHASGDLVLQEVGSRLLALAEPGIFF
ARLGGDEFGVLAQHKLTDETLVELGERICEALGQPYRVAGNVAELSGTIGWAAFPEAGTT
VAQVFERADAALYVGKESRRGTPVIFSTEHETRIRRSSLVTQELRHADLESELFLEFQPI
YDVVTQRTLGMEALGRWHNARLGAVRPEEFIRIAERTELILRITDVLLHKALDEAARWPC
ELYLSFNLSAIDICTSARAGRLIDIVLASGVPPHRVSFEITETAVTRDFEQARSSLTMIK
KAGCRVSLDDFGTGYSSLSYVHRLPFDTIKIDRSFMTDVDTNSASKKIVKSVLDLCRNLG
LECVVEGLETASQVEVVKTLGARAVQGYLFSRPMRASAIAAYLQTAQGHDYAVQMLP