Protein Info for BPHYT_RS23185 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 206 to 230 (25 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 301 to 326 (26 residues), see Phobius details amino acids 338 to 359 (22 residues), see Phobius details amino acids 366 to 384 (19 residues), see Phobius details PF12832: MFS_1_like" amino acids 12 to 166 (155 residues), 27 bits, see alignment E=2.4e-10 PF07690: MFS_1" amino acids 18 to 330 (313 residues), 92.3 bits, see alignment E=3e-30 amino acids 218 to 385 (168 residues), 48.6 bits, see alignment E=5.7e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4671)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDK1 at UniProt or InterPro

Protein Sequence (398 amino acids)

>BPHYT_RS23185 MFS transporter (Burkholderia phytofirmans PsJN)
MKSAAPVRWRAIAALTAVSALSQVGQFGIGFMVLPVWLAHRGLDAPRAGLFSAAQWTGML
AGLLIAPWLMARLGAKRTVSLGLLATLVAFAVMGTLSWPLWLVPGLLTGFGIGLRWIANE
TWLYSLVPAESSGRVVGVHEALIATAGVIGPALAVWCDVDARITFAAGAAFTFAAALPLW
LTASDERPPALQEAPPARRMSTGRRLAVGPLVSLGMVVIAAGGIGDGALYGLFPLFADAH
GLNATQTATLLTLFGVGGMALQFPVGWLADRAGLAATVIVCAALSTLAIGGFALAAPASW
LAAASALLLGGMNSSFITLGIYAAACSDKAALTRNMRLLSLTFTASSIVGPLVAGFAMNA
RGSDMLMWQLALMSGALVVYALGLREGRRQPEHSSSMG