Protein Info for BPHYT_RS23165 in Burkholderia phytofirmans PsJN

Annotation: glutamine amidotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07722: Peptidase_C26
  • amino acids 5 to 224 (220 residues), 238.6 bits, E=7e-75
• PF00117: GATase
  • amino acids 95 to 229 (135 residues), 39.4 bits, E=5.3e-14

Best Hits

Swiss-Prot: 41% identical to PUUD_ECO57: Gamma-glutamyl-gamma-aminobutyrate hydrolase (puuD) from Escherichia coli O157:H7

KEGG orthology group: K07010, putative glutamine amidotransferase (inferred from 100% identity to bpy:Bphyt_4667)

MetaCyc: 40% identical to gamma-glutamyl-gamma-aminobutyrate hydrolase (Escherichia coli K-12 substr. MG1655)
Gamma-glutamyl-gamma-aminobutyrate hydrolase. [EC: 3.5.1.94]

Predicted SEED Role

"Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94)" (EC 3.5.1.94)

MetaCyc Pathways

• superpathway of ornithine degradation (6/8 steps found)
• putrescine degradation II (3/4 steps found)
• superpathway of L-arginine and L-ornithine degradation (9/13 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (7/11 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.94

Sequence Analysis Tools

See B2TDJ7 at UniProt or InterPro

Protein Sequence (264 amino acids)

>BPHYT_RS23165 glutamine amidotransferase (Burkholderia phytofirmans PsJN)
MRKKPLVGISADRTMMGVHPSHVVGEKYIAAIVDGSQALAMLLPALGERQSAEDVLATVD
GLLFTGSYSNVEPHRYGGHPSTPGTLHDAARDATTLPLMRAAIAAGVPLLAVCRGFQEMN
VVFGGTLHQSVHAVDGLNDHRENKEDDLDVQYAPSHSITLTQGGLLQRLAGGTNEARVNS
LHGQGVERLGVGLTAEATAPDGLIEAVSVIDARAFALGVQWHPEWKHANDALSTAIFRAF
GDACRDRMRTKAGYGAASAAATHA