Protein Info for BPHYT_RS23150 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF01547: SBP_bac_1" amino acids 44 to 308 (265 residues), 63.4 bits, see alignment E=7.5e-21 PF13531: SBP_bac_11" amino acids 47 to 312 (266 residues), 30.3 bits, see alignment E=7.3e-11 PF13416: SBP_bac_8" amino acids 50 to 337 (288 residues), 115.5 bits, see alignment E=7.9e-37 PF13343: SBP_bac_6" amino acids 83 to 325 (243 residues), 66.1 bits, see alignment E=7e-22

Best Hits

Swiss-Prot: 49% identical to SPUD_PSEAE: Putrescine-binding periplasmic protein SpuD (spuD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K11073, putrescine transport system substrate-binding protein (inferred from 100% identity to bpy:Bphyt_4664)

MetaCyc: 49% identical to putrescine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine ABC transporter putrescine-binding protein PotF (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDJ4 at UniProt or InterPro

Protein Sequence (373 amino acids)

>BPHYT_RS23150 ABC transporter substrate-binding protein (Burkholderia phytofirmans PsJN)
MSVSHLRHAVAGAALLAFTGFAALSVTPALAADTELNVYNWSDYIAKDTISNFEKQDGIK
VKYDNYDSDDTLQAKLLAGSSGYDIVVPTSNYMAKQIQAGVYQKLDKSKLPNLANLDPVL
MKMIADADPGNQYGVPWAYGTDGIGYNVQAVQKALGANAPVDSWALVFDPANLSKLKGCG
VSILDQAVDVFAATLQYMHKDPNSTNPADYQAAYEVLKKIRPYITQFNSSGYINDLANND
VCVAFGWSGDVGIASRRTEEAKRSYQIKFSNVKEGGLLWFDVMVIPKDAPHPEAALKWIN
YISDPKVNAAITNEVFYPTANKAARQFVTPAVAQDKTVYPGDEVLSKMTLMKPMPTDILR
LENRLWAQLKTGH