Protein Info for BPHYT_RS23140 in Burkholderia phytofirmans PsJN

Annotation: putrescine/spermidine ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 38 to 62 (25 residues), see Phobius details amino acids 107 to 107 (1 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details amino acids 291 to 315 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 124 to 315 (192 residues), 60.5 bits, see alignment E=9.1e-21

Best Hits

Swiss-Prot: 52% identical to POTH_ECOLI: Putrescine transport system permease protein PotH (potH) from Escherichia coli (strain K12)

KEGG orthology group: K11075, putrescine transport system permease protein (inferred from 100% identity to bpy:Bphyt_4662)

MetaCyc: 52% identical to putrescine ABC transporter membrane subunit PotH (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine transport system permease protein PotH (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDJ2 at UniProt or InterPro

Protein Sequence (324 amino acids)

>BPHYT_RS23140 putrescine/spermidine ABC transporter permease (Burkholderia phytofirmans PsJN)
MSNPTTSSPAALGAPSGSRLLGSLKKRLSMLVPSGRSTVIGVPFLWLTVFFALPFVLVLK
ISFADLRLGIPPYTDLVTVKDGMVHFAMQLSHYAFLLQDDLYVATYISSLKMAAVSTFFC
LLIGYPIAYYIARSEPTKRNLLMMGVMLPFWTSFLIRVYAWIGILKDDGLLNHTLMAIGM
IHSPLRLYHTDIGVYIGMVYSYLPFMVMPLYAHLVKMDLTLLEAAYDLGCKPWTAFTRIT
LPLSKNGIIAGSLLVFIPAVGEYVIPELLGGADTLMIGRVMWDEFFNDMDWPMASAVTVA
MVLLLLVPMAVFQYYQVKELEGAK