Protein Info for BPHYT_RS22990 in Burkholderia phytofirmans PsJN

Annotation: nucleobase:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 19 to 41 (23 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 195 to 220 (26 residues), see Phobius details amino acids 240 to 265 (26 residues), see Phobius details amino acids 286 to 304 (19 residues), see Phobius details amino acids 319 to 337 (19 residues), see Phobius details amino acids 344 to 368 (25 residues), see Phobius details amino acids 380 to 402 (23 residues), see Phobius details amino acids 409 to 433 (25 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 18 to 396 (379 residues), 224.5 bits, see alignment E=9.7e-71

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4631)

Predicted SEED Role

"Xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDG2 at UniProt or InterPro

Protein Sequence (442 amino acids)

>BPHYT_RS22990 nucleobase:cation symporter (Burkholderia phytofirmans PsJN)
MNPEPAIHSVDARLPAWQLVLFGLQHVLSMAASPVTAVFLVSRMLSLPSEMTVHLIGATF
FVCGAGTLLQSLGAGSIGARLPFVMVPGGAPAMLFAVIATQTNMRTAAGAAILTSLFYWI
VLPVFARCLRFFPRVVVGTMLVLVSVSLIKIYAGIVVGQPGTPGFARPQSLGLALLTIVA
TLAVARLFKGTVGRLAVLLGLAAGTFAGWAMGLMPANGLWSGPLFTLPTLLPFGMPRFDV
LAALPMLIFSVISMAEATGQTVAVGEITGRKIDMRRDVPRTIRGDALASLIGALLGTSLI
ITSAENIGVVQTTGVRSRYVTATAGAMLMLIALFAPLGRFAYAIPAPVVGGTALIVFAMI
GVMGIDLLGKVDLHVRGNQYTLAAALVVGLIPVLVPNVYAAFPGALQIVLGNGMAAGTLT
AIVVNLVFGAWRLAPAEKVQTI