Protein Info for BPHYT_RS22750 in Burkholderia phytofirmans PsJN

Annotation: Flagellar brake protein YcgR 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF07317: PilZN" amino acids 25 to 127 (103 residues), 93.7 bits, see alignment E=6.6e-31 PF07238: PilZ" amino acids 131 to 244 (114 residues), 30.9 bits, see alignment E=3e-11

Best Hits

Swiss-Prot: 100% identical to YCGR2_PARPJ: Flagellar brake protein YcgR 2 (ycgR2) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4582)

Predicted SEED Role

"Inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TD41 at UniProt or InterPro

Protein Sequence (257 amino acids)

>BPHYT_RS22750 Flagellar brake protein YcgR 2 (Burkholderia phytofirmans PsJN)
MIADLSLDADVAEQTQQTLGADSNFAQRHPLQIAVCLRQLVAGQDFVTVEFGGRQIVTQI
LDVDSRNARFVFDAGSVADDNDALPSARQLTFRSLPGGIRTEFTTFDATPTQFDGLPAFE
APLPTVLHYVQRREFFRVQTPVLDPYIASGRYADGGSFRLELLDLSLGGIALKTADERFG
SLERGTVLRDVALQLGGFGMLRLDLEIVAPRQVSTAKGDRRFVIGCKFVATPGPAERTLQ
RVVTQLETRRQALTPRR